IL18R1 Blocking Peptide

• Catalog number
  33R-7090
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Cytokines & Growth Factors
• Tag Conjugate
  PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  IL18R1  
• Gene symbol
  IL18R1
• Short name
  IL18R1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  interleukin 18 receptor 1 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  interleukin 18 receptor 1, CD218a and CDw218a and IL-1Rrp and IL18RA and IL1RRP, IL18R1 and IDBG-64199 and ENSG00000115604 and 8809, interleukin-18 receptor activity, Plasma membranes, Il18r1 and IDBG-148535 and ENSMUSG00000026070 and 16182, IL18R1 and IDBG-630853 and ENSBTAG00000001034 and 407221

Gene info

• Identity
  HGNC:5988
• Gene
  IL18R1
• Long gene name
  interleukin 18 receptor 1
• Synonyms
  • IL1RRP
  • IL-1Rrp
  • CD218a
• GenBank acession
  • U43672
• Locus
  2q12.1
• Discovery year
  1998-12-17
• Entrez gene record
  8809
• Pubmed identfication
  • 8626725
  • 10191101
• RefSeq identity
  • NM_003855
• Classification
  • Immunoglobulin like domain containing
  • TIR domain containing
  • CD molecules
  • Interleukin receptors
• VEGA ID
  OTTHUMG00000130780

Similar products