Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Human Recombinant Mn SOD Protein

Human Recombinant Mn SOD Protein is available 3 times from Stressmark proteins labs

SPR-131A | Human Recombinant Mn SOD Protein size: 50 µg | 535.25 USD

Catalog number SPR-131A
Price 535.25 USD
Size 50 µg
Net weight (g) 0.05
1. Gene info
Identity11181
GeneSOD3
Synonyms gene name
  • superoxide dismutase 3, extracellular
Synonyms
Locus4p15.2
Discovery year1988-05-08
Havana BLAST/BLATOTTHUMG00000128565
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

SPR-131B | Human Recombinant Mn SOD Protein size: 100 µg | 944.89 USD

Loading

SPR-131C | Human Recombinant Mn SOD Protein size: 2x100 µg | 1,654.40 USD

Loading
Stock availability In Stock
Scientific context Superoxide dismutase (SOD) is an endogenously produced intracellular enzyme present in almost every cell in the body (3). It works by catalyzing the dismutation of the superoxide radical O2ˉ to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase (2, 5). In general, SODs play a major role in antioxidant defense mechanisms (4). There are two main types of SOD in mammalian cells. One form (SOD1) contains Cu and Zn ions as a homodimer and exists in the cytoplasm. The two subunits of 16 kDa each are linked by two cysteines forming an intra-subunit disulphide bridge (3). The second form (SOD2) is a manganese containing enzyme and resides in the mitochondrial matrix. It is a homotetramer of 80 kDa. The third form (SOD3 or EC-SOD) is like SOD1 in that it contains Cu and Zn ions, however it is distinct in that it is a homotetramer, with a mass of 30 kDA and it exists only in the extracellular space(8). SOD3 can also be distinguished by its heparin-binding capacity (1).
Protein target Mn SOD
Protein reactivity Human
Certificate of analysis This product has been certified >90% pure using SDS-PAGE analysis.
Protein description Human Recombinant Mn SOD Protein
Other name Manganese SOD Protein, IPO B Protein, Mn SOD Protein, SOD2 Protein
Primary research area Cancer, Oxidative Stress, Cell Signaling, Trafficking, Chaperones
Category Protein
Brand name none
Origin Recombinant
NCBI number BC070913
Gene number 24787
Protein number P04179
Verified applications WB, SDS-PAGE
Relevant bio activity Mn SOD Protein
Protein expression model E. coli
Protein charasterics See included datasheet.
Peptide sequence MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Protein purification Affinity Purified
Purity pourcentage >90% High purity
Recommended buffer for storage 50mM Tris/HCl pH7.7, 0.15M NaCl, 5mM DTT, 10% glycerol
Protein concentration Lot/batch specific. See included datasheet.
Protein specificity ~25 kDa
Protein tag His tag
Storage recommendations -20°C
Shipping recommendations Blue Ice or 4°C
Supplementary useful information Please see included datasheet or contact us
Protein cell localization Mitochondrion Matrix
Bibliography 1. Adachi T., et al. (1992) Clin. Chim. Acta. 212: 89-102. 2. Barrister J.V., et al. (1987) Crit. Rev. Biochem. 22: 111-180. 3. Furukawa Y., and O’Halloran T. (2006) Antioxidants &Redo Signaling. 8 (No 5): 6. 4. Gao B., et al. (2003). Am J Physiol Lung Cell Mol Physiol. 284: L917-L925. 5. Hassan H.M. (1988). Free Radical Biol. Med. 5: 377-385. 6. Kurobe N., et al. (1990) Clinica Chimica Acta. 192: 171-180. 7. Ojika T., et al. (1991) Acta Histochem Cytochem. 24(50): 489-495. 8. Wispe J.R., et al. (1989) BBA. 994: 30-36.
Release date 8-Jun-2009
PubMed number Not added. Please refer to PubMed
Tested applications to be tested
Tested species reactivity to be tested
Representative figure legend SDS-PAGE of 25kDa human Mn SOD (SPR-131). SDS-Page of human SOD (Mn) Protein (SPR-131)
Warnings Non-hazardous materials
Protein origin Canada
Total weight (kg) 1.4
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetSOD Protein
Short name Recombinant Mn SOD Protein
Technique Recombinant
Species Human
Alternative name H. sapiens recombinant Mn antioxidant enzyme Protein
Alternative technique rec
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Human Recombinant Mn SOD Protein size: 50 µg - Gentaur.com
Filters
+32-(0)1-658-90-45 [email protected]
  • SOD
  • Protein
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee