Recombinant Human Annexin A5(ANXA5)

• Catalog number
  RPC20220
• Price
  Please ask
• Size
  200 μg

• Verified reactivity
  Homo sapiens (Human)
• Protein number
  P08758
• Gene number
  ANXA5
• Other name
  Anchorin CII; Annexin V; Annexin-5; Calphobindin I ; CBP-IEndonexin II; Lipocortin V; Placental anticoagulant protein 4 ; PP4Placental anticoagulant protein I ; PAP-I; Thromboplastin inhibitor; Vascular anticoagulant-alpha ; VAC-alpha
• Protein origin
  Yeast
• Protein region
  2-320aa
• Protein sequence
  AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• Information about sequence
  Full Length
• Expected molecular weight
  37.8kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  This Annexin V calcium dependent phospholipid binding protein will be downstream of BCL2 pathway and at caspase apoptotic level. bioma has more cell death kits and antibodies.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Annexin   ANXA5  
• Gene symbol
  ANXA5
• Short name
  Recombinant Annexin A5(ANXA5)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-tagged
• Species
  Human, Humans
• Alternative name
  Rec. H. sapiens Annexin A5(annexin A5)
• Alternative technique
  rec
• Alternative to gene target
  annexin A5, ANX5 and ENX2 and HEL-S-7 and PP4 and RPRGL3, ANXA5 and IDBG-36172 and ENSG00000164111 and 308, calcium-dependent phospholipid binding, Cell surfaces, Anxa5 and IDBG-138625 and ENSMUSG00000027712 and 11747, BT.49277 and IDBG-639757 and ENSBTAG00000021746 and 281626

Gene info

• Identity
  HGNC:543
• Gene
  ANXA5
• Long gene name
  annexin A5
• Synonyms gene
  • ENX2
  • ANX5
• Synonyms
  • CPB-I
  • PAP-I
  • VAC-alph
  • RPRGL3
• Synonyms name
  • annexin V
  • Calphobindin I
  • Placental anticoagulant protein I
  • Vascular anticoagulant-alpha
  • endonexin II
• GenBank acession
  • U05770
• Locus
  4q27
• Discovery year
  1989-05-31
• Entrez gene record
  308
• Pubmed identfication
  • 2960376
  • 14678296
• RefSeq identity
  • NM_001154
• Classification
  • Annexins
• VEGA ID
  OTTHUMG00000133034
• Locus Specific Databases
  • LRG_606

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products