Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Ambrosia artemisiifolia Pectate lyase 5

Recombinant Ambrosia artemisiifolia Pectate lyase 5 is available 6 times from Bioma labs

RPC20116 | Recombinant Ambrosia artemisiifolia Pectate lyase 5 size: 500 μg | 1,188.60 USD

Loading

RPC20116 | Recombinant Ambrosia artemisiifolia Pectate lyase 5 size: 1 mg | 1,763.06 USD

Catalog number RPC20116
Supplier bioma
Price 1,763.06 USD
Size 1 mg
Expected molecular weight 55.82kDa
MeSH Data
Name Primary Cell Culture
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500

RPC20116 | Recombinant Ambrosia artemisiifolia Pectate lyase 5 size: 200 μg | 767.41 USD

Loading

RPC20116 | Recombinant Ambrosia artemisiifolia Pectate lyase 5 size: 50 μg | 345.11 USD

Loading

RPC20116 | Recombinant Ambrosia artemisiifolia Pectate lyase 5 size: 100 μg | 510.50 USD

Loading

RPC20116 | Recombinant Ambrosia artemisiifolia Pectate lyase 5 size: 10 μg | 181.93 USD

Loading
Verified reactivity Ambrosia artemisiifolia (Short ragweed)
Protein number P27759
Gene number Please refer to GenBank
Other name no alternative name
Protein origin E.coli
Protein region 26-396aa
Protein sequence AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHGEAAAESMKWNWRTNKDVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC
Information about sequence Full Length
Protein purity ≥ 90%
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Use before 1 year
Shipping requirements Blue ice
Estimated production time 7-11 business days
Notes For research use only. Not for diagnostic procedures.
Gene name Please refer to GenBank
Source Recombinants or rec. proteins
Group recombinants
Gene targetAmbrosia artemisiifolia Pectate lyase
Short name Recombinant Ambrosia artemisiifolia Pectate lyase 5
Technique Recombinant
Alternative name recombinant Ambrosia artemisiifolia Pectate lyase 5
Alternative technique rec
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Ambrosia artemisiifolia Pectate lyase 5 size: 1
Filters
+32-(0)1-658-90-45 [email protected]
  • Ambrosia
  • artemisiifolia
  • Pectate
  • lyase
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee