Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

C14ORF148 Blocking Peptide

C14ORF148 Blocking Peptide is available 2 times from Fitzgerald labs

33R-4517 | C14ORF148 Blocking Peptide size: 100 µg | 254.54 USD

Catalog number 33R-4517
Supplier fitzgerald
Price 254.54 USD
Size 100 µg
Alternative name A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf148 antibody, catalog no. 70R-3453
1. Gene info
Identity 20487
Gene NOXRED1
Long gene name NADP dependent oxidoreductase domain containing 1
Synonyms gene
  • C14orf148
Synonyms gene name
  • chromosome 14 open reading frame 148
Synonyms
  • FLJ32809
GenBank acession
  • AK057371
Locus 14q24.3
Discovery year 2004-06-11
Entrez gene record 122945
RefSeq identity
  • NM_138791
Havana BLAST/BLAT OTTHUMG00000171554

33R-4517 | C14ORF148 Blocking Peptide size: 100 ug | 339.39 USD

Loading
Category Proteins
Antibody Subtype Blocking Peptides
Area of research DNA & RNA
Residues KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG
Type of protein Synthetic
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Shipping conditions Blue Ice
Tested for WB; IHC
Product Type Proteins
Product Subtype Blocking Peptides
Research Area DNA & RNA
Tag/Conjugate KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG
Type1 Synthetic
Applications WB, IHC
Shipping Info Blue Ice
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetC14ORF148
Short name C14ORF148 Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative technique control
Similar products
VSTM4 shRNA Plasmid (Human) Suppplier: MyBioSource
Price: 784.23 USD
Supreme(H)-C18-5-300/10 - Reversed-Phase C18 Column Suppplier: Separation Methods Technologies, Inc.
Price: 750.29 USD
NVS-PAK1-1 25mg Suppplier: ChemScene
Price: 749.08 USD
Assay kit for human Alpha methylacyl CoA racemase AMACR ELISA Suppplier: BlueGen ELISAs
Price: 733.32 USD
PHF3 Antibody - C-terminal region Suppplier: aviva
Price: 513.93 USD
DPY30 Mouse monoclonal Antibody IgG1 Suppplier: Bon Opus
Price: 415.75 USD
BP-1-102 10mg Suppplier: ChemScene
Price: 399.99 USD
ADAMTSL3 Antibody Suppplier: Bioss Primary Unconjugated Antibodies
Price: 318.78 USD
DDX50 Rabbit Polyclonal Suppplier: MyBioSource
Price: 6.06 USD
Human APC2 CRISPR Knock Out Cell Line Suppplier: ABM CrispR
Price: 7 055.63 USD
MOUSE ANTI PIG CD14 Suppplier: MyBioSource
Price: 6.06 USD
Recombinant Campylobacter Fetus rpsL Protein (aa 1-127) Suppplier: Creative Biolabs
Price: 1 323.61 USD
C6orf150 Over-expression Lysate reagent Suppplier: genways
Price: 1 058.16 USD
Igll1 3'UTR Luciferase Stable Cell Line Suppplier: ABM microrna
Price: 0.00 USD
Ask
Ajax processing
Close
C14ORF148 Blocking Peptide | Technique alternative | 0101191
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • C14ORF148
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee