Recombinant Sheep Interleukin-4(IL4)

  • Catalog number
    RPC20454
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Ovis aries (Sheep)
  • Protein number
    P30368
  • Gene number
    IL4
  • Other name
    B-cell stimulatory factor 1
  • Protein origin
    E.coli
  • Protein region
    25-135aa
  • Protein sequence
    HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
  • Information about sequence
    Full Length of Mature Protein
  • Expected molecular weight
    37.32kD
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Gene
    Interleukin 4 (IL4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. It is used for dendritic and T cell therapy. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th0 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. Recombinant, GMP rec. E. coli interleukin-4 for cell culture supplied by GENTAUR. Free samples on request.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    IL4
  • Short name
    Recombinant Interleukin-4(IL4)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Sheep
  • Species
    Sheep, The sheep (Ovis aries) ELISAs are detecting sheep proteins and antigens. Some epitopes will also recognize goat proteins. Sheep and goats are also used to produce polyclonals. An adult female sheep is referred to as a ewe a male as a ram, a castrated male as a wether, and a younger sheep as a lamb. Sheeps
  • Alternative name
    Rec. ovine Interleukin-4(interleukin 4)
  • Alternative technique
    rec
  • Alternative to gene target
    interleukin 4, BCGF-1 and BCGF1 and BSF-1 and BSF1 and IL-4, IL4 and IDBG-42701 and ENSG00000113520 and 3565, growth factor activity, Extracellular, Il4 and IDBG-172024 and ENSMUSG00000000869 and 16189, IL4 and IDBG-644671 and ENSBTAG00000015957 and 280824
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee