Recombinant Rat Frataxin, mitochondrial(Fxn),Partial

  • Catalog number
    RPC20538
  • Price
    Please ask
  • Size
    10 μg
  • Verified reactivity
    Rattus norvegicus (Rat)
  • Protein number
    D3ZYW7
  • Gene name
    Fxn
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    41-208AA
  • Protein sequence
    LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
  • Information about sequence
    Partial
  • Expected molecular weight
    22,15kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Frataxin, mitochondrial(Fxn),Partial
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Label
    N-terminal 10xHis-tagged
  • Species
    Rat, Rats
  • Alternative name
    Rec. Rat Frataxin, mitochondrial(frataxin),Partial
  • Alternative technique
    rec
  • Alternative to gene target
    frataxin, CyaY and FA and FARR and FRDA and X25, FXN and IDBG-69240 and ENSG00000165060 and 2395, 2 iron, Cytoplasm, Fxn and IDBG-154568 and ENSMUSG00000059363 and 14297, FXN and IDBG-631850 and ENSBTAG00000001306 and 505694
  • Tissue
    mitochondrial
MeSH Data
  • Name
  • Concept
    Scope note: An in vitro allergen radioimmunoassay in which allergens are coupled to an immunosorbent. The coupled allergens bind the IgE in the sera of patients which in turn binds radioisotope-labeled anti-IMMUNOGLOBULIN E antibodies.
  • Tree numbers
    • E01.370.225.812.735.830
    • E05.200.812.735.830
    • E05.478.566.380.810
    • E05.478.566.639.810
    • E05.478.594.760.830
    • E05.601.470.380.810
    • E05.601.470.639.810
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee