Recombinant E. coli Ecotin (C-6His)

  • Catalog number
    C130-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant E.coli Ecotin is produced by our E.coli expression system and the target gene encoding Met1-Arg162 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    E.coli
  • Origin
    Escherichia coli
  • Peptide sequence
    MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVRLEHHHHHH
  • Estimated molecular weight
    19,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 300mM NaCl, pH 8.5.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P23827
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Ecotin   C-6His  
  • Short name
    Recombinant Ecotin (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    e. coli, Escherichia coli, Recombination of bioactive proteins and longer peptides in Escherichia Coli is done often with His tagging. novo supplies Rec. E. Coli affinity purified or tag purified antigens in 1 quantities or bulk volumes on request.
  • Species
    E. coli, E. coli
  • Alternative name
    E.coli Ecotin(C-6His)
  • Alternative technique
    rec, escherichia
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee