Recombinant Human Diacylglycerol kinase alpha(DGKA)

  • Catalog number
    RPC20460
  • Price
    Please ask
  • Size
    100 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P23743
  • Gene number
    DGKA
  • Other name
    80 kDa diacylglycerol kinase; Diglyceride kinase alpha
  • Protein origin
    E.coli
  • Protein region
    1-735aa
  • Protein sequence
    MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
  • Information about sequence
    Full Length
  • Expected molecular weight
    85.58kD
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    The Recombinant Diacylglycerol kinase alpha(DGKA) is a α- or alpha protein sometimes glycoprotein present in blood.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    DGKA
  • Short name
    Recombinant Diacylglycerol kinase alpha(DGKA)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6XHis-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Diacylglycerol phosphorylation catalyst a(diacylglycerol kinase, alpha 80kDa)
  • Alternative technique
    rec
  • Alternative to gene target
    diacylglycerol kinase, alpha 80kDa, DAGK and DAGK1 and DGK-alpha, DGKA and IDBG-39397 and ENSG00000065357 and 1606, phospholipid binding, Plasma membranes, Dgka and IDBG-198283 and ENSMUSG00000025357 and 13139, DGKA and IDBG-636422 and ENSBTAG00000004018 and 506348
Gene info
  • Identity
  • Gene
  • Long gene name
    diacylglycerol kinase alpha
  • Synonyms gene
  • Synonyms gene name
    • diacylglycerol kinase, alpha (80kD)
    • diacylglycerol kinase, alpha 80kDa
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1991-08-21
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Diacylglycerol kinases
    • EF-hand domain containing
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee