-
Target antigen
TGFBR2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the TGFBR2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The TGFBR2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
TGFBR2 (transforming growth factor, beta receptor II (70/80kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II( TGF-beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. A TGFBR2 cDNA encodes a deduced 565-amino acid protein with a calculated molecular mass of approximately 60 kD in length. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
-
Related articles
1. Hagen, G., Muller, S., Beato, M., Suske, G. Cloning by recognition site screening of two novel GT box binding proteins: a family of Sp1 related genes. Nucleic Acids Res. 20: 5519-5525, 1992. 2. Lin, H. Y., Wang, X.-F., Ng-Eaton, E., Weinberg, R. A., Lodish, H. F. Expression cloning of the TGF-beta type II receptor, a functional transmembrane serine/threonine kinase. Cell 68: 775-785, 1992. 3. Hahm, K.-B., Cho, K., Lee, C., Im, Y.-H., Chang, J., Choi, S.-G., Sorensen, P. H. B., Thiele, C. J., Kim, S.-J.Repression of the gene encoding the TGF-beta type II receptor is a major target of the EWS-FLI1 oncoprotein. Nature Genet. 23: 222-227, 1999.
-
Gene Name
TGFBR2
-
Protein Name
TGF-beta receptor type-2
-
Gene Full Name
transforming growth factor, beta receptor II (70/80kDa)
-
Synonyms
AAT 3 antibody|AAT3 antibody|FAA 3 antibody|FAA3 antibody|HNPCC6 antibody|LDS1B antibody|LDS2B antibody|MFS 2 antibody|MFS2 antibody| RIIC antibody|TAAD 2 antibody|TAAD2 antibody|TbetaR II antibody|TbetaR-II antibody|TGF beta receptor type 2 antibody|TGF beta receptor type II antibody|TGF beta receptor type IIB antibody|TGF beta type II receptor antibody|TGF-beta receptor type II antibody|TGF-beta receptor type-2 antibody|TGF-beta type II receptor antibody|TGFB R2 antibody|TGFbeta RII antibody|TGFBR 2 antibody|TGFBR2 antibody| TGFR 2 antibody|TGFR-2 antibody|TGFR2 antibody|TGFR2_HUMAN antibody|Transforming growth factor beta receptor II antibody|Transforming growth factor beta receptor type II antibody|Transforming growth factor beta receptor type IIC antibody|Transforming growth factor-beta receptor type II antibody
-
Uniprot ID
P37173
-
Entrez GeneID
7048
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
