Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Metaxin 2 antibody

Metaxin 2 antibody is available 1 time from Fitzgerald labs

70R-2450 | Metaxin 2 antibody size: 50 µg | 571.66 USD

Catalog number 70R-2450
Supplier fitzgerald
Price 571.66 USD
Size 50 µg
1. Gene info
Identity 7506
Gene MTX2
Long gene name metaxin 2
GenBank acession
  • AF053551
Locus 2q31.1
Discovery year 1999-07-14
Entrez gene record 10651
Pubmed identfication
  • 10381257
  • 17624330
RefSeq identity
  • NM_006554
Classification
  • Metaxins
Havana BLAST/BLAT OTTHUMG00000132514
Category Primary Antibody
Antibody Subtype Polyclonal Antibodies, Purified
Area of research Cell Biology
Type of Immunogen Metaxin 2 antibodies were raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA
Raised in Rabbit
Specificity Metaxin 2 antibody was raised against the N terminal of MTX2
Cross Reactivity Human
Method of Purification Affinity purified
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTX2 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions Blue Ice
Tested for WB
Usage Recommendations WB: 1 ug/ml
Assay Information Metaxin 2 Blocking Peptide, catalog no. 33R-10130, is also available for use as a blocking control in assays to test for specificity of this Metaxin 2 antibody
Additional Information This is a rabbit polyclonal antibody against MTX2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetMetaxin
Short name Metaxin 2 antibody
Technique Antibody
Alternative name Rabbit polyclonal Metaxin 2 antibody raised against the N terminal of MTX2
Alternative technique antibodies
Similar products
Metaxin 2 antibody Suppplier: MyBioSource
Price: 665.54 USD
Anti-FBXO24 (Polyclonal), ALEXA Fluor 594 Suppplier: Bioss Polyclonal Antibodies
Price: 588.51 USD
Metaxin 1 antibody Suppplier: fitzgerald
Price: 571.66 USD
CD47 siRNA (Rat) Suppplier: MyBioSource
Price: 545.19 USD
GFPT1-His Adenovirus (Human) Suppplier: abm Adinovirus
Price: 518.71 USD
TNF-alfa(71-82), human Suppplier: CHI Scientific
Price: 515.10 USD
Metaxin 2 Antibody Suppplier: Abbexa
Price: 406.78 USD
Metaxin 1 Antibody Suppplier: Abbexa
Price: 406.78 USD
SmD3 Primary Antibody Suppplier: EnoGene
Price: 355.03 USD
BSA Conjugated Cyanocobalamin CNCbl Suppplier: Cloud Clone Corp
Price: 257.55 USD
Metaxin 1 antibody Suppplier: MyBioSource
Price: 6.02 USD
Human AT rich interactive domain containing protein 3C ARID3C Suppplier: MBS Recombinant
Price: 2 600.76 USD
Mouse RYR1 ELISA Kit Suppplier: Abbexa
Price: 1 106.02 USD
Ask
Ajax processing
Close
Metaxin 2 antibody | Technique alternative | 01011943459
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Metaxin
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee