Recombinant Rat Cellular tumor antigen p53(Tp53)

  • Catalog number
    RPC20212
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Rattus norvegicus (Rat)
  • Protein number
    P10361
  • Gene number
    Tp53
  • Other name
    Tumor suppressor p53
  • Protein origin
    E.coli
  • Protein region
    1-391aa
  • Protein sequence
    MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
  • Information about sequence
    Full Length
  • Expected molecular weight
    47.5kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Antigens are peptides or recombinant or native dependent on the production method.
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Cellular   tumor   p53   Tp53  
  • Short name
    Recombinant Cellular tumor antigen p53(Tp53)
  • Technique
    Recombinant, cellular, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Label
    N-terminal 6xHis-tagged
  • Species
    Rat, Rats
  • Alternative name
    Rec. Rat Cellular tumor protein p53(tumor protein p53)
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    tumor protein p53, BCC7 and LFS1 and P53 and TRP53, TP53 and IDBG-26364 and ENSG00000141510 and 7157, MDM2/MDM4 family protein binding, nuclei, Trp53 and IDBG-191036 and ENSMUSG00000059552 and 22059, TP53 and IDBG-635147 and ENSBTAG00000001069 and 281542
  • Tissue
    cellular, tumor
MeSH Data
  • Name
  • Concept
    Scope note: A cytologic technique for measuring the functional capacity of tumor stem cells by assaying their activity. It is used primarily for the in vitro testing of antineoplastic agents.
  • Tree numbers
    • E01.370.225.500.383.910
    • E01.370.225.500.388.930
    • E05.200.500.383.910
    • E05.200.500.388.930
    • E05.242.383.910
    • E05.242.417.500
    • E05.337.550.200.800
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee