Recombinant Human ß-Nerve Growth Factor/ß-NGF (Ser122-Ala241, E. coli)

  • Catalog number
    C060-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human beta-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Ser122-Ala241 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
  • Estimated molecular weight
    13,4 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 250mM NaCl, pH 7.0.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P01138
  • Additional description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    NGF, NGF-AS1
  • Short name
    Recombinant ß-Nerve Growth Factor/ß-NGF (Ser122-Ala241, )
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    e. coli, Escherichia coli, Recombination of bioactive proteins and longer peptides in Escherichia Coli is done often with His tagging. novo supplies Rec. E. Coli affinity purified or tag purified antigens in 1 quantities or bulk volumes on request.
  • Species
    E. coli, Humans
  • Alternative name
    Human beta-NGF(E.coli)
  • Alternative technique
    rec, escherichia
  • Alternative to gene target
    nerve growth factor (beta polypeptide), Beta-NGF and HSAN5 and NGFB, NGF and IDBG-101347 and ENSG00000134259 and 4803, growth factor activity, Extracellular, Ngf and IDBG-180362 and ENSMUSG00000027859 and 18049, NGF and IDBG-648895 and ENSBTAG00000007446 and 281350
  • Tissue
    nerve
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee