Recombinant Human papillomavirus type 16 Protein E6(E6)

  • Catalog number
    RPC20140
  • Price
    Please ask
  • Size
    10 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P03126
  • Gene name
    E6
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    1-158aa
  • Protein sequence
    MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
  • Information about sequence
    Full Length
  • Expected molecular weight
    23,3kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant papillomavirus 16 Protein E6(E6)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens papillomavirus classification 16 Protein E6(E6)
  • Alternative technique
    rec
MeSH Data
  • Name
  • Concept
    Scope note: Methods for detecting or typing the DNA of an ALPHAPAPILLOMAVIRUS in biological tissues and fluids.
  • Tree numbers
    • E01.370.225.880.500
    • E05.200.880.500
    • E05.393.520.750
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee