Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial
-
Catalog number
RPC20038
-
Price
Please ask
-
Size
1 mg
-
-
Verified reactivity
Homo sapiens (Human)
-
Protein number
P55899
-
Gene number
FCGRT
-
Other name
IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
-
Protein origin
E.coli
-
Protein region
24-297aa
-
Protein sequence
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
-
Information about sequence
Extracellular Domain
-
Expected molecular weight
57.8kDa
-
Protein purity
≥ 90%
-
Storage recommendation
Aliquot and store at -20°C. Minimize freezing and thawing.
-
Use before
1 year
-
Shipping requirements
Blue ice
-
Estimated production time
7-11 business days
-
Notes
For research use only. Not for diagnostic procedures.
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
About
Immunoglobulin gamma, IgG, mouse monoclonal H&L chain clones or rabbit, goat polyclonal antibodies have 4 parts. There are 2 heavy chains, 2 light chains. The IgG antibody has 2 antigen binding sites. They represent 70% or more of serum antibodies. This antibody can be antigen purified or protein A or G purified. For storage sodium azide is added or you can call us to request azide free antibody preparations. These will need colder storage temperatures.
-
Description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
FCGRT
-
Short name
Recombinant IgG receptor FcRn subunit p51(FCGRT),partial
-
Technique
Recombinant, IgG, IgGs, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Isotype
IgG, IgG
-
Label
N-terminal GST-tagged
-
Species
Human, Humans
-
Alternative name
Rec. H. sapiens Immunoglobulin G receptor FcRn large functionnal sequence p51(fragment c fragment on Immunoglobulin G, receptor, transporter, alpha),partial
-
Alternative technique
rec, immunoglobulins
-
Alternative to gene target
Fc fragment of IgG, receptor, transporter, alpha, alpha-chain and FCRN, FCGRT and IDBG-63001 and ENSG00000104870 and 2217, beta-2-microglobulin binding, Plasma membranes, Fcgrt and IDBG-181534 and ENSMUSG00000003420 and 14132, FCGRT and IDBG-640575 and ENSBTAG00000013926 and 338062
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products