PDE5A Antibody
-
Catalog numberA02490-2
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenPDE5A
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman
-
AnalysesWB,IHC-P
-
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20-63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH), different from the related mouse sequence by eight amino acids.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the PDE5A Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe PDE5A Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundcGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.
-
Related articles1. Gebska, M. A., Stevenson, B. K., Hemnes, A. R., Bivalacqua, T. J., Haile, A., Hesketh, G. G., Murray, C. I., Zaiman, A. L., Halushka, M. K., Krongkaew, N., Strong, T. D., Cooke, C. A., El-Haddad, H., Tuder, R. M., Berkowitz, D. E., Champion, H. C.Phosphodiesterase-5A (PDE5A) is localized to the endothelial caveolae and modulates NOS3 activity. Cardiovasc. Res. 90: 353-363, 2011. 2. Lin, C.-S., Chow, S., Lau, A., Tu, R., Lue, T. F. Human PDE5A gene encodes three PDE5 isoforms from two alternate promoters.Int. J. Impotence Res. 14: 15-24, 2002. 3. Loughney, K., Hill, T. R., Florio, V. A., Uher, L., Rosman, G. J., Wolda, S. L., Jones, B. A., Howard, M. L., McAllister-Lucas, L. M., Sonnenburg, W. K., Francis, S. H., Corbin, J. D., Beavo, J. A., Ferguson, K. Isolation and characterization of cDNAs encodingPDE5A, a human cGMP-binding, cGMP-specific 3-prime,5-prime-cyclic nucleotide phosphodiesterase. Gene 216: 139-147, 1998.
-
Gene NamePDE5A
-
Protein NamecGMP-specific 3',5'-cyclic phosphodiesterase
-
Gene Full Namephosphodiesterase 5A
-
SynonymsCGB PDE | CGB-PDE | CGBPDE | CN5A | CN5N | PDE 5 | PDE 5A | PDE5 | Pde5a | PDE5A1 | O76074
-
Uniprot IDO76074
-
Entrez GeneID8654
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolPDE5A
-
Short namePDE5A Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative namephosphodiesterase 5A, cGMP-specific (antibody to-)
-
Alternative techniqueantibodies
-
Alternative to gene targetphosphodiesterase 5A, cGMP-specific, CGB-PDE and CN5A and PDE5, PDE5A and IDBG-35773 and ENSG00000138735 and 8654, 3', Cytoplasm, Pde5a and IDBG-191818 and ENSMUSG00000053965 and 242202, PDE5A and IDBG-639844 and ENSBTAG00000024888 and 281972
-
Gene info
-
Identity
-
Gene
-
Long gene namephosphodiesterase 5A
-
Synonyms gene name
- phosphodiesterase 5A, cGMP-specific
-
GenBank acession
-
Locus
-
Discovery year1998-11-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Phosphodiesterases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data