PDE5A Antibody

• Catalog number
  A02490-2
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  PDE5A
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20-63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH), different from the related mouse sequence by eight amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the PDE5A Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The PDE5A Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  cGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.
• Related articles
  1. Gebska, M. A., Stevenson, B. K., Hemnes, A. R., Bivalacqua, T. J., Haile, A., Hesketh, G. G., Murray, C. I., Zaiman, A. L., Halushka, M. K., Krongkaew, N., Strong, T. D., Cooke, C. A., El-Haddad, H., Tuder, R. M., Berkowitz, D. E., Champion, H. C.Phosphodiesterase-5A (PDE5A) is localized to the endothelial caveolae and modulates NOS3 activity. Cardiovasc. Res. 90: 353-363, 2011. 2. Lin, C.-S., Chow, S., Lau, A., Tu, R., Lue, T. F. Human PDE5A gene encodes three PDE5 isoforms from two alternate promoters.Int. J. Impotence Res. 14: 15-24, 2002. 3. Loughney, K., Hill, T. R., Florio, V. A., Uher, L., Rosman, G. J., Wolda, S. L., Jones, B. A., Howard, M. L., McAllister-Lucas, L. M., Sonnenburg, W. K., Francis, S. H., Corbin, J. D., Beavo, J. A., Ferguson, K. Isolation and characterization of cDNAs encodingPDE5A, a human cGMP-binding, cGMP-specific 3-prime,5-prime-cyclic nucleotide phosphodiesterase. Gene 216: 139-147, 1998.
• Gene Name
  PDE5A
• Protein Name
  cGMP-specific 3',5'-cyclic phosphodiesterase
• Gene Full Name
  phosphodiesterase 5A
• Synonyms
  CGB PDE | CGB-PDE | CGBPDE | CN5A | CN5N | PDE 5 | PDE 5A | PDE5 | Pde5a | PDE5A1 | O76074
• Uniprot ID
  O76074
• Entrez GeneID
  8654
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PDE5A  
• Gene symbol
  PDE5A
• Short name
  PDE5A Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  phosphodiesterase 5A, cGMP-specific (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  phosphodiesterase 5A, cGMP-specific, CGB-PDE and CN5A and PDE5, PDE5A and IDBG-35773 and ENSG00000138735 and 8654, 3', Cytoplasm, Pde5a and IDBG-191818 and ENSMUSG00000053965 and 242202, PDE5A and IDBG-639844 and ENSBTAG00000024888 and 281972

Gene info

• Identity
  HGNC:8784
• Gene
  PDE5A
• Long gene name
  phosphodiesterase 5A
• Synonyms gene name
  • phosphodiesterase 5A, cGMP-specific
• GenBank acession
  • D89094
• Locus
  4q26
• Discovery year
  1998-11-24
• Entrez gene record
  8654
• Pubmed identfication
  • 9714779
  • 9642111
• RefSeq identity
  • NM_001083
• Classification
  • Phosphodiesterases
• VEGA ID
  OTTHUMG00000132971

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products