GAA Antibody

  • Catalog number
    A01548
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    GAA
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    mouse, rat
  • Analyses
    WB,IHC-P
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the GAA Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The GAA Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Lysosomal alpha-glucosidase is an enzyme that in humans is encoded by the GAA gene. This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Alternative splicing results in multiple transcript variants.
  • Related articles
    1. "Entrez Gene: GAA glucosidase, alpha; acid (Pompe disease, glycogen storage disease type II)". 2. Donald J. Voet; Judith G. Voet; Charlotte W. Pratt (2008). "Additional Pathways in Carbohydrate Metabolism". Principles of Biochemistry, Third edition. Wiley. p. 538. 3. Reuser AJ, Kroos MA, Hermans MM, et al. (1995). "Glycogenosis type II (acid maltase deficiency).". Muscle Nerve. 3: S61–9.
  • Gene Name
    GAA
  • Protein Name
    Lysosomal alpha-glucosidase
  • Gene Full Name
    glucosidase alpha, acid
  • Synonyms
    Acid alpha glucosidase | Acid maltase | Aglucosidase alfa | Alpha glucosidase | GAA | Glucosidase alpha acid | Glucosidase alpha | LYAG | P10253
  • Uniprot ID
    P10253
  • Entrez GeneID
    2548
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    GAA  
  • Gene symbol
    GAA, TRF-GAA12-1, TRF-GAA4-1, TRF-GAA8-1, TRF-GAA7-1, TRF-GAA10-1, TRF-GAA3-1, TRF-GAA6-1, TRF-GAA9-1, TRF-GAA2-1
  • Short name
    GAA Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    GAA (antibody to-)
  • Alternative technique
    antibodies
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 12-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 14 (anticodon GAA) pseudogene
    • transfer RNA-Phe (GAA) 12-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Cytoplasmic transfer RNA pseudogenes
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 4-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 9 (anticodon GAA)
    • transfer RNA-Phe (GAA) 4-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 8-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 13 (anticodon GAA) pseudogene
    • transfer RNA-Phe (GAA) 8-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNA pseudogenes
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 7-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 12 (anticodon GAA)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNA pseudogenes
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 10-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 16 (anticodon GAA) pseudogene
    • transfer RNA-Phe (GAA) 10-1
    • tRNA-Phe (GAA) 10-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Cytoplasmic transfer RNA pseudogenes
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 3-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 5 (anticodon GAA)
    • transfer RNA-Phe (GAA) 3-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 6-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 8 (anticodon GAA)
    • transfer RNA-Phe (GAA) 6-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 9-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 17 (anticodon GAA) pseudogene
    • transfer RNA-Phe (GAA) 9-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Cytoplasmic transfer RNA pseudogenes
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Phe (anticodon GAA) 2-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA phenylalanine 1 (anticodon GAA)
    • transfer RNA-Phe (GAA) 2-1
    • tRNA-Phe (GAA) 2-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2007-02-01
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Cytoplasmic transfer RNAs
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee