LIF, murine recombinant

  • Catalog number
    4924-1000
  • Price
    Please ask
  • Size
    1 mg
  • Synonyms
    Leukemia Inhibitory Factor
  • Alternative_names
    Leukemia Inhibitory Factor, Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor, INN=Emfilermin
  • Description
    A cytokine that affects cell growth by inhibiting differentiation
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥95%
  • Assay
    SDS-PAGE
  • Purity
    ≥95%
  • Molecular Weight
    20.0 kDa
  • Storage Temp
    -20°C
  • Shipping
    Gel pack
  • Shelf Life
    12 months
  • Appearance
    Lyophilized protein
  • Physical form description
    Lyophilized from sterile solution containing 20 mM phosphate buffer, pH 7.4 and 0.02% Tween-20
  • Reconstitution Instructions
    Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers.
  • Background Information
    Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence. Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.
  • Amino acid sequence
    MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    LIF   murine  
  • Gene symbol
    LIF-AS1, LIF-AS2, LIF
  • Short name
    LIF, murine recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative name
    leukemia inhibitory factor, murine Rec.
  • Alternative technique
    rec
  • Alternative to gene target
    leukemia inhibitory factor, CDF and DIA and HILDA and MLPLI, LIF and IDBG-3968 and ENSG00000128342 and 3976, growth factor activity, Extracellular, Lif and IDBG-142317 and ENSMUSG00000034394 and 16878, LIF and IDBG-636335 and ENSBTAG00000007424 and 280840
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    LIF antisense RNA 2
  • Locus
  • Discovery year
    2020-10-07
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Antisense RNAs
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Methods or procedures used to obtain samples of URINE.
  • Tree numbers
    • E01.370.225.998.762
    • E05.200.998.762
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee