-
Stock availability
In Stock
-
Scientific context
p23 is a highly conserved ubiquitous protein, known to have an important function as a cochaperone for the HSP90 chaperoning system (1). Studies have revealed that p23 is a small protein (18 to 25 kDa) with a simple structure (2, 3). p23 does not have any structural homology with any other known proteins (1). p23 was first discovered as a part of the HSP90-progesterone receptor complex along with HSP70, p54 and p50 (1). p23 is a phosphor-protein, which is highly acidic and has an aspartic acid-rich c-terminal domain (1). Numerous studies have found p23 to be associated with other client proteins like Fes tyrosine kinase (4), the heme regulated kinase HRI (5), hsf1 transcription factor (4), aryl hydrocarbon receptor (4), telomerase (6), and Hepadnavirus reverse transcriptase (7). In spite of several years of study, the exact functional significance of p23 is still not clear (8). p23 is thought to be involved in the adenosine triphosphate–mediated HSP90 binding of client proteins (8). Since many HSP90 client proteins are involved in oncogenic survival signaling, a recent study has concluded p23 to be a promising target in leukemic apoptosis (9). HSP90 and its co-chaperone p23 are certainly among the emerging anti-tumor targets in oncology.
-
Protein target
p23
-
Protein reactivity
Human
-
Certificate of analysis
This product has been certified >90% pure using SDS PAGE analysis. 4uM SPR-303, when added to 2uM SPR-300 (Aha1)-activated HSP90 (2uM; His-tagged HSP90 beta) in 33mM Hepes pH7.2, 30mM NaCl, 5mM MgCl2, 1mM DTT, 1.5mM ATP in a 100ul reaction at 37 degrees C, eliminated all Aha1-mediated ATPase stimulation as well as intrinsic HSP90 ATPase activity. (This is an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm).
-
Protein description
Human Recombinant p23 Protein
-
Other name
Sid 3177 Protein, Co chaperone p23 Protein, cPGES Protein, HSP90 co chaperone Protein, cytosolic prostaglandin E2 synthase Protein, PTGES3 Protein, TEBP Protein
-
Primary research area
Cancer, Heat Shock
-
Category
Protein
-
Brand name
none
-
Origin
Recombinant
-
NCBI number
NP_006592.3
-
Gene number
10728
-
Protein number
Q15185
-
Verified applications
WB, SDS-PAGE, Functional Assay
-
Relevant bio activity
p23 Protein
-
Protein expression model
E. coli
-
Protein charasterics
See included datasheet.
-
Peptide sequence
SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
-
Protein purification
Affinity Purified
-
Purity pourcentage
>90% High purity
-
Recommended buffer for storage
20mM HEPES buffer pH7.2, 80mM NaCl, 10% glycerol
-
Protein concentration
Lot/batch specific. See included datasheet.
-
Protein specificity
~23 kDa
-
Protein tag
No tag
-
Storage recommendations
-20°C
-
Shipping recommendations
Blue Ice or 4°C
-
Supplementary useful information
Please see included datasheet or contact us
-
Protein cell localization
Cytoplasm
-
Bibliography
1. Johnson J.L., Beito T. G., Krco C.J. & Toft D.O. (1994) Mol Cell Biol. 14: 1956-63. 2. Weikl T., Abelmann K. & Buchner J. (1999) J Mol Biol. 293: 685-91. 3. Weaver A.J., Sullivan W.P., Felts S.J., Owen B.A. & Toft, D.O. (2000) J Biol Chem. 275: 23045-52. 4. Nair S.C., et al. (1996) Cell Stress Chaperones. 1: 237-50. 5. Xu Z., et al. (1997) Eur J Biochem. 246, 461-70. 6. Holt S.E., et al. (1999) Genes Dev. 13: 817-26. 7. Hu J., Toft D., Anselmo D. & Wang X. (2002) J Virol. 76: 269-79. 8. Felts S.J. & Toft D.O. (2003) Cell Stress Chaperones. 8: 108-13. 9. Gausdal G., Gjertsen B.T., Fladmark K.E., Demol H., Vandekerckhove J. & Doskeland S.O. (2004) Leukemia.
-
Release date
31-Jul-2009
-
PubMed number
Not added. Please refer to PubMed
-
Tested applications
to be tested
-
Tested species reactivity
to be tested
-
-
Representative figure legend
SDS-PAGE of native human 23kDa p23 protein (SPR-303). SDS-Page of human p23 Protein (SPR-303)
-
Warnings
Non-hazardous materials
-
Protein origin
Canada
-
Total weight kg
1.4
-
Net weight g
0.1
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
