Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

TRPV5 antibody

TRPV5 antibody is available 1 time from Fitzgerald labs

70R-5176 | TRPV5 antibody size: 50 µg | 542.69 USD

Loading
Category Primary Antibody
Tested for WB
Raised in Rabbit
Product Subtype Purified Polyclonal Antibodies
Antibody Subtype Polyclonal Antibodies, Purified
Method of Purification Affinity purified
Specificity TRPV5 antibody was raised against the N terminal of TRPV5
Additional Information This is a rabbit polyclonal antibody against TRPV5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
Immunogen TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
Shipping Info Blue Ice
Shipping conditions Blue Ice
Assay Information TRPV5 Blocking Peptide, catalog no. 33R-6206, is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody
Applications WB
Research Area Signal Transduction
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPV5 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Usage Recommendations WB: 1 ug/ml
Product Type Primary Antibodies
Type of Immunogen TRPV5 antibodies were raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
Area of research Signal Transduction
Cross Reactivity Human
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetTRPV5
Short name TRPV5 antibody
Technique Antibody
Alternative name TRPV5 (Antibody to)
Alternative technique antibodies
Similar products
TRPV5 antibody Suppplier: MyBioSource
Price: 379.31 USD
TRPV5, Mouse Monoclonal antibody-; Clone: 6D6 Suppplier: accurate-monoclonals
Price: 0.00 USD
TRPV5 antibody Suppplier: genways
Price: 595.24 USD
TRPV5 antibody - N-terminal region Suppplier: aviva
Price: 357.60 USD
TRPV5 antibody Suppplier: SAB
Price: 490.13 USD
Rabbit TRPV5 antibody Suppplier: fitzgerald
Price: 565.54 USD
Ask
Ajax processing
Close
TRPV5 antibody - fitzgerald - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee