Rabbit DGKE antibody
-
Catalog number70R-5996
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenDGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR
-
SpecificityDGKE antibody was raised against the N terminal of DGKE
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGKE antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDGKE
-
Short nameRabbit DGKE antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DGKE antibody raised against the N terminal of DGKE
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetdiacylglycerol kinase, epsilon 64kDa, DAGK5 and DAGK6 and DGK and NPHS7, DGKE and IDBG-60172 and ENSG00000153933 and 8526, metal ion binding, Plasma membranes, Dgke and IDBG-208183 and ENSMUSG00000000276 and 56077, DGKE and IDBG-629244 and ENSBTAG00000004449 and 538147
-
Gene info
-
Identity
-
Gene
-
Long gene namediacylglycerol kinase epsilon
-
Synonyms gene name
- diacylglycerol kinase, epsilon (64kD)
- diacylglycerol kinase, epsilon 64kDa
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-10-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Diacylglycerol kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data